SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008293 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008293
Domain Number 1 Region: 334-392,435-449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000139
Family I set domains 0.034
Further Details:      
 
Domain Number 2 Region: 251-329
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000792
Family I set domains 0.026
Further Details:      
 
Domain Number 3 Region: 31-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000911
Family I set domains 0.082
Further Details:      
 
Domain Number 4 Region: 157-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000753
Family C2 set domains 0.069
Further Details:      
 
Domain Number 5 Region: 385-491
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000878
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008293   Gene: ENSGGOG00000008482   Transcript: ENSGGOT00000008522
Sequence length 583
Comment pep:known_by_projection chromosome:gorGor3.1:3:104473184:104687032:1 gene:ENSGGOG00000008482 transcript:ENSGGOT00000008522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIMPCRLDVPQNLMFGKWKYEK
PDGSPVFIAFRSSTKKSVQYDDVPEYKDRLSLSENYTLSISNARISDEKRFVCMLVTEDN
VFEAPTIVKVFKQPSKPEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPL
EGAVVIIFKKEMDPVTQLYTMTSTLEYKTTKADIQMPFTCSVTYYGPSGQKTIHSEQAVF
DIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTL
TDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASR
NATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEEN
VTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAA
LVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
Download sequence
Identical sequences A0A2I2ZP40
ENSGGOP00000008293 ENSGGOP00000008293 XP_004036057.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]