SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008301 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008301
Domain Number 1 Region: 32-258
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.97e-74
Family Eukaryotic type heme oxygenase 0.000000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008301   Gene: ENSGGOG00000008494   Transcript: ENSGGOT00000008530
Sequence length 316
Comment pep:known_by_projection chromosome:gorGor3.1:16:4718136:4754119:1 gene:ENSGGOG00000008494 transcript:ENSGGOT00000008530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVETSEGVDESEKKNSGAVEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
WEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQA
GSTLARETLEHGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFQTAMAVLRKPSLQFIL
AAGVALAAGLLAWYYM
Download sequence
Identical sequences G3QZI8
ENSGGOP00000008301 ENSGGOP00000008301 XP_018867344.1.27298 XP_018867345.1.27298 XP_018867346.1.27298 XP_018867347.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]