SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008325 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008325
Domain Number 1 Region: 335-431
Classification Level Classification E-value
Superfamily Immunoglobulin 8.81e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 81-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000236
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 3 Region: 494-785
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000000262
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.044
Further Details:      
 
Domain Number 4 Region: 256-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000018
Family V set domains (antibody variable domain-like) 0.09
Further Details:      
 
Domain Number 5 Region: 179-247
Classification Level Classification E-value
Superfamily EF-hand 0.00000000108
Family Parvalbumin 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008325   Gene: ENSGGOG00000008514   Transcript: ENSGGOT00000008555
Sequence length 847
Comment pep:known_by_projection chromosome:gorGor3.1:4:171899923:172671405:-1 gene:ENSGGOG00000008514 transcript:ENSGGOT00000008555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKCWSVVLVLGFIFPESEGRPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDG
PFGSCENKYCGLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACL
KKQKITIVHNEDCFFKGDKCKTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLV
DQMFKYFDADSNGLVDINELTQVIKQEELGKDLFDCTLYVLLKYDDFNADKHLALEEFYR
AFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWKRNNIILNNLDLEDINDF
GDDGSLYITKVTTTHVGNYTCYADGYEQVYQTHIFQVNVPPVIRVYPESQAREPGVTASL
RCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSE
KLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVST
DPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQFDRVDD
FFIPTTTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCVPQSLAHTHLGGY
YFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGLVRVQY
ITIRGEIQEAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLLVELSSGKVKMIK
SLKEPLKAEEWPWNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNT
VIWVGDA
Download sequence
Identical sequences ENSGGOP00000008325 ENSGGOP00000008325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]