SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008350 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008350
Domain Number 1 Region: 19-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000199
Family V set domains (antibody variable domain-like) 0.0088
Further Details:      
 
Domain Number 2 Region: 147-221
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000391
Family C2 set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008350   Gene: ENSGGOG00000008540   Transcript: ENSGGOT00000008580
Sequence length 290
Comment pep:known_by_projection chromosome:gorGor3.1:9:5488758:5508256:1 gene:ENSGGOG00000008540 transcript:ENSGGOT00000008580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIFAVFIFTTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLFLGVALTFIFCLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
Download sequence
Identical sequences G3QZN5
ENSGGOP00000008350 ENSGGOP00000008350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]