SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008372 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008372
Domain Number 1 Region: 544-590
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 2 Region: 123-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 63-111
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000102
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008372   Gene: ENSGGOG00000008556   Transcript: ENSGGOT00000008603
Sequence length 591
Comment pep:known_by_projection chromosome:gorGor3.1:1:58715458:58752313:-1 gene:ENSGGOG00000008556 transcript:ENSGGOT00000008603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNSRTWAWRVPAELFLLCACLGCLSLPGSRGERPHSFESNAVNKSFAKSRQMRSVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYANLLQPSQFHGEPCNFSDKEVEDCVTSRPCRSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYMPQTQGKYEFILKDYESYSDF
ERKVTEKTASRSGFSFGFKMPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFA
YSSTVKQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYWK
NIPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Download sequence
Identical sequences ENSGGOP00000008372 ENSGGOP00000008372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]