SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008390 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008390
Domain Number 1 Region: 27-124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000046
Family V set domains (antibody variable domain-like) 0.00000542
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008390
Domain Number - Region: 138-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0523
Family C2 set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008390   Gene: ENSGGOG00000008578   Transcript: ENSGGOT00000008621
Sequence length 329
Comment pep:known_by_projection chromosome:gorGor3.1:3:121672335:121738305:1 gene:ENSGGOG00000008578 transcript:ENSGGOT00000008621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPQCTMGLSNTLFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNRSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM
IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI
EYDGAMRKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTRLLSSPFSIELEDPQ
PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKQPRNSYKCGTNTMEREESEQTKKREN
IHIPERSDEAQRVFKSSKTSSCDKSDTCF
Download sequence
Identical sequences G3QZS4
XP_004036211.1.27298 ENSGGOP00000008390 ENSGGOP00000008390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]