SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008437 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008437
Domain Number 1 Region: 406-520
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.4e-18
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 208-257
Classification Level Classification E-value
Superfamily EF-hand 0.0000144
Family Calmodulin-like 0.088
Further Details:      
 
Domain Number 3 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008437
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 127-221
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.022
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008437   Gene: ENSGGOG00000008626   Transcript: ENSGGOT00000008669
Sequence length 535
Comment pep:known_by_projection chromosome:gorGor3.1:19:11653143:11668700:1 gene:ENSGGOG00000008626 transcript:ENSGGOT00000008669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLRTVK
EEAEKPEREAKEQHQKLWEEQLAAAKAQQEQELAADAFKELDDDMDGTVSVTELQTHLEL
DTDGDGALSEAEAQALLSGDTQIDATSFYDRVWAAIRDKYRSEALPTDLPAPSAPDLTEP
KEEQPPVPSSPTEEEEEEEEEEEEEAEEEEEEEDSEVQGEQPEEAPPPLSPPQPASPAEE
DRMPPYDEQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYS
QCYELTTNEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWVGPDHDKFSAMKYEQGTGCWQ
GPNRSTTVRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
Download sequence
Identical sequences G3QZW7
ENSGGOP00000008437 ENSGGOP00000008437 XP_018870608.1.27298 XP_018870609.1.27298 XP_018870610.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]