SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008461 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008461
Domain Number 1 Region: 29-154,186-551
Classification Level Classification E-value
Superfamily Sema domain 3.27e-177
Family Sema domain 0.0000000000499
Further Details:      
 
Domain Number 2 Region: 613-696
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000191
Family I set domains 0.055
Further Details:      
 
Domain Number 3 Region: 547-598
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000288
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008461   Gene: ENSGGOG00000008650   Transcript: ENSGGOT00000008694
Sequence length 785
Comment pep:known_by_projection chromosome:gorGor3.1:3:51458363:51487092:1 gene:ENSGGOG00000008650 transcript:ENSGGOT00000008694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVTGLLLWACLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRIL
LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDVNGECGNFVR
LIQPWNRTHLYVCGTGAYNPVCTYVNRGRRAQATPWTQTQAVRGRGSRATDGALRPTPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQ
TAMRTDQYNSRWLNDPSFIHAELIPDSAERNDDKLYFFFRERSAEAPQSPAVYARIGRIC
LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFT
SSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPS
MKSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTVAVDQVDAADGRYEV
LFLGTDRGTVQKVIVLPKDDQEMEELMLEEVEVFKDPAPVKTMTISSKRQQLYVASAVGV
THLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDIRHGNPIRQCRG
FNSNANKNAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPGDRRREIRAEDRFLRTE
QGLLLRALQLSDRGLYSCTATENNFKHVVTRVQLHVLGRDAVHAALFPPLSVSAPPPPGA
GPPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGAPRSPEPQDQKKPRNRRH
HPPDT
Download sequence
Identical sequences A0A2I2YUI3
ENSGGOP00000008461 XP_018879190.1.27298 ENSGGOP00000008461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]