SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008495 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008495
Domain Number 1 Region: 643-842
Classification Level Classification E-value
Superfamily Fibronectin type III 6.91e-33
Family Fibronectin type III 0.00012
Further Details:      
 
Domain Number 2 Region: 845-1039
Classification Level Classification E-value
Superfamily Fibronectin type III 2.38e-32
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 345-444
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-18
Family I set domains 0.0075
Further Details:      
 
Domain Number 4 Region: 261-358
Classification Level Classification E-value
Superfamily Immunoglobulin 8.89e-18
Family I set domains 0.0078
Further Details:      
 
Domain Number 5 Region: 451-537
Classification Level Classification E-value
Superfamily Immunoglobulin 3.07e-17
Family I set domains 0.02
Further Details:      
 
Domain Number 6 Region: 34-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000022
Family I set domains 0.0087
Further Details:      
 
Domain Number 7 Region: 139-225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000543
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 547-667
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000839
Family V set domains (antibody variable domain-like) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008495   Gene: ENSGGOG00000008679   Transcript: ENSGGOT00000008728
Sequence length 1193
Comment pep:known_by_projection chromosome:gorGor3.1:3:307292:395609:1 gene:ENSGGOG00000008679 transcript:ENSGGOT00000008728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLLLGRGLIVSLIFFLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAK
GNPEPTFSWTKDGNPFYFTDHRIITSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMS
EEIEFIVPTGVPKFPKEKIDPLEVEEGDPVVLPCNPPKGLPPLHIYWMNIELEHIEQDER
VYMSQKGDLYFANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVNSLDEIYNEIPERCG
VTEFYFVANSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVDWNKIGG
DLPKGRETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQS
AVYSTGSNGILLCEAEGEPQPTIKWRVNGSPVDNLVDSYKSKERRFSGTEISFTNLQPNH
TAVYQCEASNVHGTILANANIDVVDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVV
SWQKVEEVKPLEGRRYHIYENGTLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRIKT
DATKLRVSPKNPRIPKSHMLELHCERKHDITQLDRLLWALMQGTEVLFQEDRIIIDGANL
TISNVTLEDQGIYCCSAHTALDSAADITQVTVLVHTWPPLIKNVPDPPENLHLSERQNRS
VRLTWEAGADHNSDISEYIVEFEGNKEEPGRWDELTRVQGKKTTVILPLAPFVRYQFRVI
AVNEVGRSQPSQPSDHHETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEY
RVTWKPQGAPVEWEEETVTNHTLRVMTPAVYAPYDVKVQAINQLGSGPDPQSVTLYSGED
YPDTAPVIHGVDVINSTLVKVTWSTVPKDRVHGRLKGYQINWWKTKSLLDGRTHPKEVNI
LRFSGQRNSGMVPSLDAFSEFHLTVLAYNSKGAGPESEPYIFQTPEGVPEQPTFLKVIKV
DKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEIGELNDINITTPSKPSWHLSNLNATT
KYKFYLRACTSQGCGKPITEESSTLGEGKYAGLYDDISTQGWFIGLMCAIALLTLLLLTV
CFVKRNRGGKYSVKEKEDLHPDPEIQSVKDETFGEYSDSDEKPLKGSLRSLNRDMQPTES
ADSLVEYGEGDHGLFSEDGSFIGAYAGSKEKGSVESNENRQKVPIVQGSNSYI
Download sequence
Identical sequences ENSGGOP00000008495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]