SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008536 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008536
Domain Number 1 Region: 200-234,328-641
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.22e-40
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 
Domain Number 2 Region: 14-235,276-365
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.57e-19
Family WD40-repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008536   Gene: ENSGGOG00000008728   Transcript: ENSGGOT00000008770
Sequence length 697
Comment pep:known_by_projection chromosome:gorGor3.1:1:44663658:44700840:1 gene:ENSGGOG00000008728 transcript:ENSGGOT00000008770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVVAQTLHVFGLRSHVANNIFYFDEQIIVFPSGNHCVKYNVDQKWQKFIPGSEKSQGM
LALSISPNRRYLAISETVQEKPAITIYELSSIPCRKRKVLNNFDFQVQKFISMAFSPDSK
YLLAQTSPPESNLVYWLWEKQKVMAIVRIDTQNNPVYQVSFSPQDNTQVCVTGNGMFKLL
RFAEGTLKQTNFQRGEPQNYLAHTWVADDKIVIGTDTGKLFLFESGDQRWETSIMVKEPT
DGSKSLDVIQESESLIEFPPVSSPLPSYEQMVAASSHSQMSMPQVFAIAAYSKGFACSAG
PGRVLLFEKMEEKDFYRESREIRIPVDPQSNDPSQSDKQDVLCLCFSPSEETLVASTSKN
QLYSITMSLTEISKGEPAHFEYLMYPLHSAPITGLATCIRKPLIATCSLDRSIRLWNYET
NTLELFKEYQEEAYSISLHPSGHFIVVGFADKLRLMNLLIDDIRSFKEYSVRGCGECSFS
NGGHLFAAVNGNVIHVYTATSLENISSLKGHTGKIRSIVWNADDSKLISGGTDGAVYEWN
LSTGKRETECVLKSCSYNCVTVSPDAKIIFAVGSDHTLKEIADSLILREISAFDVTYTAI
VISHSGRMMFVGTSVGTIRAMKYPLPLQKEFNEYQAHAGPITKVSRALSPGTQSHTCLLR
LFIPSTSQCLFSLLLLSCLFIHHSLNHHLLTMNILFV
Download sequence
Identical sequences ENSGGOP00000008537 ENSGGOP00000008536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]