SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008544 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008544
Domain Number 1 Region: 6-193
Classification Level Classification E-value
Superfamily ITPase-like 4.97e-59
Family ITPase (Ham1) 0.00000000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008544   Gene: ENSGGOG00000008741   Transcript: ENSGGOT00000008778
Sequence length 197
Comment pep:known_by_projection chromosome:gorGor3.1:20:3262841:3277359:1 gene:ENSGGOG00000008741 transcript:ENSGGOT00000008778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLVGKKIVFVTGNAKKLEEEQVVQILGDKFPCTLVAQKIDQVPEYQGEPDEISIQKC
QEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCT
FALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSH
RFRALLELQEYFGSLAA
Download sequence
Identical sequences ENSGGOP00000008544 ENSGGOP00000008544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]