SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008621 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008621
Domain Number 1 Region: 365-557
Classification Level Classification E-value
Superfamily Fibronectin type III 5.24e-48
Family Fibronectin type III 0.00000174
Further Details:      
 
Domain Number 2 Region: 717-914
Classification Level Classification E-value
Superfamily Fibronectin type III 4.13e-35
Family Fibronectin type III 0.00000133
Further Details:      
 
Domain Number 3 Region: 218-311
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-23
Family I set domains 0.0093
Further Details:      
 
Domain Number 4 Region: 558-686
Classification Level Classification E-value
Superfamily Fibronectin type III 7.9e-22
Family Fibronectin type III 0.00000291
Further Details:      
 
Domain Number 5 Region: 120-212
Classification Level Classification E-value
Superfamily Immunoglobulin 3.9e-18
Family I set domains 0.03
Further Details:      
 
Domain Number 6 Region: 23-126
Classification Level Classification E-value
Superfamily Immunoglobulin 9.29e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 7 Region: 309-359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000592
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008621   Gene: ENSGGOG00000008812   Transcript: ENSGGOT00000008857
Sequence length 1322
Comment pep:known_by_projection chromosome:gorGor3.1:15:52612405:52860797:1 gene:ENSGGOG00000008812 transcript:ENSGGOT00000008857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARSGSTPQSPGASIRTFTPFYFLVEPVDTLSVRGSSVILNCSAYSEPSPKIEWKKDGTF
LNLVSDDRRQLLPDGSLFISNVVHSKHNKPDEGYYQCVATVESLGTIISRTAKLIVAGLP
RFTSQPEPSSVYAGNNAILNCEVNADLVPFVRWEQNRQPLLLDDRVIKLPSGMLVISNAT
EGDGGLYRCVVESGGPPKYSDEVELKVLPDPEVTSDLVFLKQPSPLVRVIGQDVVLPCVA
SGLPTPTIKWMKNEEALDTESSERLVLLAGGSLEISDVTEDDAGTYFCIADNGNETIEAQ
AELTVQAQPEFLKQPTNIYAHESMDIVFECEVTGKPTPTVKWVKNGDMVIPSDYFKIVPA
TTGPLPSAPRDVVASLVSTRFIKLTWRTPASDPHGDNLTYSVFYTKEGIARERVENTSHP
GEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPEVQLPGPAPNLRAYAASPT
SITVTWETPVSGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLKKYTEYSFRVVAYN
KHGPGVSTPDVAVRTLSDGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLDETRVP
EVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENL
DPSSHYVITLKAFNNVGEGIPLYESAVTRPHTDTSEVDLFVINAPYTPVPDPTPMMPPVG
VQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTG
LKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQP
PSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKG
MGPMSEAVQFRTPKADSSDKMPNDQASGSGGKGSRLPDLGSDYKPPMSGSNSPHGSPTSP
LDSNMLLVIIVSVGVITIVVVVIIAVFCTRRTTSHQKKKRAACKSVNGSHKYKGNSKDVK
PPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHE
SEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDNPHHHFHSSSLASPARSHLY
HPGSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASSSQTCCTDHQDPEGATSSSYLASS
QEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPAYDPALPSTPLLSQQALNHHIHSVKT
ASIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSYEPDELTKEMAHLEGLMKDLNAIT
TA
Download sequence
Identical sequences ENSGGOP00000008621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]