SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008903 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008903
Domain Number 1 Region: 248-332
Classification Level Classification E-value
Superfamily Immunoglobulin 1.77e-20
Family I set domains 0.029
Further Details:      
 
Domain Number 2 Region: 512-593
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000721
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 593-681
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000136
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 139-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000138
Family C1 set domains (antibody constant domain-like) 0.075
Further Details:      
 
Domain Number 5 Region: 342-449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000926
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 418-505
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000109
Family I set domains 0.051
Further Details:      
 
Domain Number 7 Region: 27-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000151
Family V set domains (antibody variable domain-like) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008903   Gene: ENSGGOG00000009101   Transcript: ENSGGOT00000009149
Sequence length 847
Comment pep:known_by_projection chromosome:gorGor3.1:19:32612730:32632147:1 gene:ENSGGOG00000009101 transcript:ENSGGOT00000009149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLLGPWLLLLVLEYLAFCDSSKWAFEHPETLYAWEGACVWIPCTYRALDGDLESFILFH
NPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKKKNCTLSIHPVHVNDSGQLGLR
MESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEG
VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKH
TPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPMYTTVSWLKDGTSLKKQNTLTLNLSEVT
KDQSGKYYCQVSNDVGPERSAEVFLQVQYAPEPSTVQILHSPAVEGSEVEFLCMSLANPL
PTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK
KVTTVIQNPTPIREGDTVTLSCNYNSSNPSVTRYEWKAHGTWEEPSLGVLKIQNIGWDNT
TIACAACNNWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQ
FFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM
SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQ
GTNSVGKGRSPLSTLNVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG
LQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPETNIPRTGDAET
SEMQSPPPDCDDTVTYSVLHKRQMGDYENVIPDFSEDEGIHYSELIQFGVGERPQAQENV
DYVILKH
Download sequence
Identical sequences G3R153
XP_004060557.1.27298 ENSGGOP00000008903 ENSGGOP00000008903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]