SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009068 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009068
Domain Number 1 Region: 1335-1647
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000161
Further Details:      
 
Domain Number 2 Region: 1612-1900
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.07e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000619
Further Details:      
 
Domain Number 3 Region: 318-512
Classification Level Classification E-value
Superfamily Fibronectin type III 3.67e-47
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 4 Region: 821-1008
Classification Level Classification E-value
Superfamily Fibronectin type III 2.94e-40
Family Fibronectin type III 0.00068
Further Details:      
 
Domain Number 5 Region: 510-708
Classification Level Classification E-value
Superfamily Fibronectin type III 1.01e-39
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 6 Region: 696-824
Classification Level Classification E-value
Superfamily Fibronectin type III 1.49e-23
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 7 Region: 32-134
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-18
Family I set domains 0.003
Further Details:      
 
Domain Number 8 Region: 230-323
Classification Level Classification E-value
Superfamily Immunoglobulin 1.72e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 9 Region: 135-227
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 10 Region: 1017-1100
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000403
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009068   Gene: ENSGGOG00000009263   Transcript: ENSGGOT00000009321
Sequence length 1908
Comment pep:known_by_projection chromosome:gorGor3.1:1:45029620:45118435:1 gene:ENSGGOG00000009263 transcript:ENSGGOT00000009321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEEQLPPGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPATS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVTYYGIQYRAAGTE
GPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPNAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERI
IMYELVYWVAEDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEAR
TAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHVVD
GISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL
NSTAVHVYWKLPVPSKQHGQIRGYQVTYVRLENGEPRGLPIIQDVMLAEAQWRPEESEDY
ETTISGLTPETTYSITVAAYTTKGDGARSKPKIVTTTGAVPGRPTMMISTTAMNTALLQW
HPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGL
GEEFEKEIRTPEDLPSGFPQNLRVTGLTTSTTELAWDPPVLAERNGRITSYTVVFRDINS
QQELQNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMPVEQVFAKNFRV
AAAMKTSVLLSWEVPDSYKSAVPFKILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNR
GSSAGGLQHLVSIRTAPDLLPHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYIVVVPID
RVGGSMLTPRWSTPEELELDELLEAIEQGGEEQRRRRRRQAERLKPYVAAQLDVLPETFT
LGDKKNYRGFYNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEP
EMLWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRL
NYQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKN
RYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVW
EQRTATVVMMTRLEEKSRVKCDQYWPARGTETYGLIQVTLLDTVELATYTVRTFALHKSG
SSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFI
VIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARN
LYAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELT
RVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLT
KLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQ
FTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERM
RYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
Download sequence
Identical sequences G3R1J3
ENSGGOP00000009068 ENSGGOP00000009068 XP_018872408.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]