SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009136 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009136
Domain Number 1 Region: 20-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000075
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 
Domain Number 2 Region: 134-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000281
Family C1 set domains (antibody constant domain-like) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009136   Gene: ENSGGOG00000009350   Transcript: ENSGGOT00000009390
Sequence length 393
Comment pep:known_by_projection chromosome:gorGor3.1:11:120928459:120964621:1 gene:ENSGGOG00000009350 transcript:ENSGGOT00000009390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWRVLSLLAWFPLQEASLTNHTETITVEEGQTLTLKCVTSLRKTSSLQWLTPSGFTIFL
NEYPAFKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFK
PILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTHHEFETDGKKCNTT
SSLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQ
PTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSGILLLTLVSFLIFI
LFIIVQLFIMKLRKAHVIWKKENEVSEHTLESYRSRSNNEETSSQEKNGQSSHPMRCMNY
ITKLYSEAKTKRKENVQHSKLEEKHIQVPESIV
Download sequence
Identical sequences G3RP88
ENSGGOP00000009136 XP_004052352.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]