SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009192 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009192
Domain Number 1 Region: 13-199
Classification Level Classification E-value
Superfamily The spindle assembly checkpoint protein mad2 3.66e-45
Family The spindle assembly checkpoint protein mad2 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009192   Gene: ENSGGOG00000009404   Transcript: ENSGGOT00000009446
Sequence length 224
Comment pep:known_by_projection chromosome:gorGor3.1:1:11928940:11935469:-1 gene:ENSGGOG00000009404 transcript:ENSGGOT00000009446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSIRWAAPAPRPL
AGISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIK
DFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
Download sequence
Identical sequences A0A2K6P9K3 B1AK44
ENSGGOP00000009192 ENSP00000365843 ENSGGOP00000009192 ENSP00000365857 ENSP00000365860 ENSP00000365857 ENSP00000365860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]