SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009376 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000009376
Domain Number - Region: 28-133
Classification Level Classification E-value
Superfamily Chelatase 0.0719
Family Ferrochelatase 0.076
Further Details:      
 
Domain Number - Region: 134-202
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0759
Family Chemotaxis phosphatase CheZ 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009376   Gene: ENSGGOG00000009602   Transcript: ENSGGOT00000009640
Sequence length 235
Comment pep:known_by_projection chromosome:gorGor3.1:15:21274197:21292216:1 gene:ENSGGOG00000009602 transcript:ENSGGOT00000009640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAKSWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEI
YQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQE
NLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTET
EELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTTNAK
Download sequence
Identical sequences A0A2I2Y5F1
XP_018866339.1.27298 ENSGGOP00000009376 ENSGGOP00000009376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]