SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009627 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009627
Domain Number 1 Region: 13-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000113
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 2 Region: 131-167,343-408
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000218
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 137-184,282-320
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000081
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009627   Gene: ENSGGOG00000009851   Transcript: ENSGGOT00000009894
Sequence length 444
Comment pep:known_by_projection chromosome:gorGor3.1:1:18790584:18950427:1 gene:ENSGGOG00000009851 transcript:ENSGGOT00000009894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYLTVNIEPLPPVVAGDAVTLKCNFKTDGRMREIVWYRVTDGGTIKQKIFTFDAMFSTNY
SHMENYRKREDLVYQSTVRLPEVRISDNGPYECHVGIYDRATREKVVLASGNIFLNVMAP
PTSIEVVAADTPAPFSRYQAQNFTLVCIVSGGKPAPMVYFKRDGEPIDAVPLSEPPAASS
GPLQDSRPFRSLLHRDLDDTKMQKSLSLLDAENRGGRPYTERPSRGLTPDPNILLQPTTE
NIPETVVSREFPRWVHSAEPTYFLRHSRTPSSDGTVEVRALLTWTLNPQIDNEALFSCEV
KHPALSMPMQAEVTLVAPKGPKIVMTPSRARVGDTVRILVHGFQNEVFPEPMFTWTRVGS
RLLDGSAEFDGKELVLERVPAELNGSMYRCTAQNPLGSTDTHTRLIVFENPNIPRGTEDS
NGSTGPTGARLTLVLALTVILELT
Download sequence
Identical sequences ENSGGOP00000009627 ENSGGOP00000009627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]