SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009633 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009633
Domain Number 1 Region: 27-108
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.11e-27
Family MHC antigen-recognition domain 0.00000591
Further Details:      
 
Domain Number 2 Region: 110-206
Classification Level Classification E-value
Superfamily Immunoglobulin 3.56e-24
Family C1 set domains (antibody constant domain-like) 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009633   Gene: ENSGGOG00000009861   Transcript: ENSGGOT00000009900
Sequence length 254
Comment pep:known_by_projection chromosome:gorGor3.1:6:33327472:33332638:1 gene:ENSGGOG00000009861 transcript:ENSGGOT00000009900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSGVPVLGFFIIAVLMRTQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS
PVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK
GVRKSNAAERRGPL
Download sequence
Identical sequences G3R317
XP_004043811.1.27298 ENSGGOP00000009633 ENSGGOP00000009633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]