SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009675 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009675
Domain Number 1 Region: 69-172,258-351
Classification Level Classification E-value
Superfamily Fibronectin type III 2.05e-31
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 380-472
Classification Level Classification E-value
Superfamily Immunoglobulin 4.3e-23
Family I set domains 0.0047
Further Details:      
 
Domain Number 3 Region: 182-271
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000132
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009675   Gene: ENSGGOG00000009899   Transcript: ENSGGOT00000009944
Sequence length 493
Comment pep:known_by_projection chromosome:gorGor3.1:1:183153193:183161210:-1 gene:ENSGGOG00000009899 transcript:ENSGGOT00000009944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEKNTSEGPACSPEETASESAKVPTAEPPGEVAVSESTREEQVPKPQAPDPQAPTASTA
TKPAPPSEDVPSAPLLLTLEDVSSSSVTVSWEPPERLGRLGLQGYVLELCREGASEWVPV
SARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQPIHIRENIEAPKIRVPRHL
RQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRVSMRTGDQDSILFIRSAQRSD
SGRYELTVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAALQWTPPQDTGNTELLG
YTVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGLSTSATVTKELAH
IQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQLFCSVRASPKPKIIWMKNKM
EIQGNPKYRALSEQGVCTLEIRKPSPFDSGVYTCKAINVLGEASVDCRLEVKGESHTEES
WEEAVMRSQVLQA
Download sequence
Identical sequences ENSGGOP00000009675 ENSGGOP00000009675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]