SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009761 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009761
Domain Number 1 Region: 25-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000207
Family V set domains (antibody variable domain-like) 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009761   Gene: ENSGGOG00000010002   Transcript: ENSGGOT00000010040
Sequence length 373
Comment pep:known_by_projection chromosome:gorGor3.1:1:186892028:186908864:-1 gene:ENSGGOG00000010002 transcript:ENSGGOT00000010040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGT
VVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTL
NVHSEYEPSWEKQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSP
TTQITHRPRVSRASSVAGDKPPTFLPSTTASKVSALEGLLKPQTPSYNHHTRLHRQRALD
YGSQSGREGQGFHILLPTILGLFLLALLGLVVKRAVERRKALSRRARRLAVRMRALQSSQ
RPRGSPRPRSQNNIYSACPRRARGADAAAASVSESPWLHAPSLKTSCEYVSLYHQPATMM
EDSDSDDYINVPA
Download sequence
Identical sequences ENSGGOP00000009761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]