SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009769 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009769
Domain Number 1 Region: 23-131
Classification Level Classification E-value
Superfamily Immunoglobulin 7.62e-23
Family V set domains (antibody variable domain-like) 0.00000164
Further Details:      
 
Domain Number 2 Region: 465-562
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000331
Family V set domains (antibody variable domain-like) 0.02
Further Details:      
 
Domain Number 3 Region: 240-352
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000401
Family V set domains (antibody variable domain-like) 0.0094
Further Details:      
 
Domain Number 4 Region: 355-452
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000446
Family V set domains (antibody variable domain-like) 0.0012
Further Details:      
 
Domain Number 5 Region: 138-239
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000171
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009769   Gene: ENSGGOG00000010007   Transcript: ENSGGOT00000010048
Sequence length 764
Comment pep:known_by_projection chromosome:gorGor3.1:1:186759986:186934568:-1 gene:ENSGGOG00000010007 transcript:ENSGGOT00000010048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFVLTCLLAVFPAISTKSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGA
RGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLS
FDVSLEVSQGPGLLNDTKVYTVDLGRTVTIDCPFKTENAPKRKSLYKQIGLYPVLVIDSS
GYVNPNYTGRIRLDIQGTGQLVFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKP
EPELVYEDLRGSVTFHCALGLEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLN
PQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVK
GVAGGSVAVLCPYNPKESKSIKYWCLWEGAQNGRCPLLVESEGRVKEQYEGRLSLLEEPG
NGTFTVILNQLTSQDAGFYWCLTNGDTRWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKV
PCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNPVTRADEG
WYWCGVKQGHFYGETAAIYVAVEERKAAESRDVSLAKADAAPDEKVLDSGVREIENKAIQ
DPRLVAEEKAAADTRDQADGSRASVDSGSSEEQGGSSRALVSTLVPLGLVLAVGAVAVGV
ARARHRKNVDRVSIRSYRTDISMSDFENSREFGANDNMGASSITQETSLGGKDEFVATTE
STTETKEPKKAKRSSKEEAEMAYKDFLLQSSTVAAEAQDGPQEA
Download sequence
Identical sequences G3R3E4
ENSGGOP00000009769 ENSGGOP00000009769 XP_004028344.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]