SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009774 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009774
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily POZ domain 5.23e-25
Family BTB/POZ domain 0.0036
Further Details:      
 
Domain Number 2 Region: 887-939
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.18e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 830-882
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000417
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 977-1028
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000078
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 1069-1122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000343
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 6 Region: 806-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000598
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009774
Domain Number - Region: 734-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000106
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 943-987
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00041
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 1129-1156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00399
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number - Region: 1046-1079
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00952
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009774   Gene: ENSGGOG00000010010   Transcript: ENSGGOT00000010053
Sequence length 1239
Comment pep:known_by_projection chromosome:gorGor3.1:1:23198574:23278584:1 gene:ENSGGOG00000010010 transcript:ENSGGOT00000010053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPNYSQQLLQQLYTLCKEQQFCDCTISIGTIYFRAHKLVLAAASLLFKTLLDNTDTIS
IDASVVSPEEFALLLEMMYTGKLPVGKHNFSKIISLADSLQMFDVAVSCKNLLTSLVNCS
VQGQVVRDVSAPSSETFRKEPEKPQVEILSSEGAGEPHSSPELAATPGGPVKAETEEAAH
SVSQEMSVNSPTAQESQRNAETPAETPTTAEACSLSPAVQTFSEAKKTSTEPACERKHYQ
LNFLLENEGIFSDALMVTQDVLKKLEMCSEIKGPQKEMIVKCFEGEGGHSAFQRILGKVR
EESLDVQTVVSLLRLYQYSNPAVKTALLDRKPEDVDTVQPKGSTEEGKTLSVLLLEHRED
LIQCVTQLRPIMEFLETAKEEFLTGTEKRVILNCCEGRTPKETIENLLHRMTEEKTLTAE
GLVKLLQAVKMTFPNLGLLLEKLQKSATLPSATVQPSPDDYGTELLRRYHENLSEIFTDN
QILLKMISHMTSLAPGEREVMEKLVKRDSGSGGFNSLISAVLEKQTLSATAVWQLLLVVQ
ETKTCPLDLLMEEIRREPGADTFFRAVTTPERATLETILRHNQLILEAIQQKIECKLFTS
EEEHLAETVKEILSISSETASPEASLRAVLSRAMEKSVPAIEICHLLCSVHKSFPGLQPV
MQELAYIGVLTKEDGEKETWKVSNKFHLEANNKEDEKAAKEDSQPGEQNDQGETGSLPGQ
QEKEASASPDPAKKSFICKACDKSFHFYCRLKVHMKRCRVAKSKQVQCKECSETKDSKKE
LEKHQLEAHGAGGEPDAPKKKKKRLPVTCDLCGREFAHASGMQYHKLTEHFDEKPFSCEE
CGAKFAANSTLKNHLRLHTGDRPFMCKHCLMTFTQASALAYHTKKKHSEGKMYACQYCDA
VFAQSIELSRHVRTHTGDKPYVCRDCGKGFRQANGLSIHLHTFHNIEDPYDCKKCRMSFP
TLQDHRKHIHEVHSKEYHPCPTCGKIFSAPSMLERHMVTHVGGKPFSCGICNKAYQQLSG
LWYHNRTHHPDVFAAQNHRSSKFSSLQCSSCDKTFPNTIEHKKHIKAEHADMKFHECDQC
KELFPTPALLQVHVKCQHSGSQPFRCLYCAATFRFPGALQHHVTTEHFKQSETTFPCELC
GELFTSQAQLDSHLESEHPKVMSTETQAAASQMAQVIQTPEPVAPTEQVITLEETQLAGS
QVFVTLPDSQASQASSELVAVTVEDLLDGTVTLICGEAK
Download sequence
Identical sequences G3R3E8
ENSGGOP00000009774 XP_004024904.1.27298 XP_004024905.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]