SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009776 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009776
Domain Number 1 Region: 111-219
Classification Level Classification E-value
Superfamily Immunoglobulin 4.13e-19
Family V set domains (antibody variable domain-like) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009776   Gene: ENSGGOG00000010014   Transcript: ENSGGOT00000010056
Sequence length 577
Comment pep:known_by_projection chromosome:gorGor3.1:1:186946263:186958734:-1 gene:ENSGGOG00000010014 transcript:ENSGGOT00000010056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGEATVKPGEQKEVVRRGREVDYSRLIAGTLPQSHVTSRRAGWKMPLFLILCLLQGSSF
ALPQKRPHPRWLWEGSLPSRTHLRAMGTLTPSSPLCWREESSFAAPNSLKGSRLVSGEPG
GAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGF
FVVRLSQLSPDDIGCYLCGIGSENNMLFLSMNLTISAGPASTLPTATPAAGELTMRSYGT
ASPVANRWTPGTTQTLGQGTAWDTVASTPGTSMTTASAEGRRTPGATRPAAPGTGSWAEG
SVKAPAPIPESPPSKSRSMSNITEGVWEGTRSSVTNRARASKDRREMTTTKADRPREDIE
GVRIALDAAKKVLGTIGPPALVSETLAWEILPQAMPVSKQQSQGSIGETTPAAGMWTLGT
PAADVWILGTPAADVWTSMEAASGEGSAAGDLDAATGDRGPQATLSQAPAVGPWGPPGKE
SSVKRTFPDDESSSRTLAPVSTMLALFMLMALVLLQRKLWRRRTSQEAERVTLIQMTHFL
EVNPQPDQLPHVERKMLQDDSLPAGASLTAPERNPGP
Download sequence
Identical sequences ENSGGOP00000009776 ENSGGOP00000009776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]