SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009804 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009804
Domain Number 1 Region: 36-141
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-25
Family V set domains (antibody variable domain-like) 0.0013
Further Details:      
 
Domain Number 2 Region: 151-233
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-18
Family I set domains 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009804   Gene: ENSGGOG00000010044   Transcript: ENSGGOT00000010084
Sequence length 293
Comment pep:novel chromosome:gorGor3.1:19:38880909:38891586:1 gene:ENSGGOG00000010044 transcript:ENSGGOT00000010084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPSARPHRECIPWQGLLLIASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPE
NLYSYGWYKGKTVEPNQLIAAYVTDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYY
TLQVRYRNSQIEQASHHLRVYESVAQPSIQASSTTVTEKGSVVLTCRTNNTGTSFQWIFN
NQRLQVTKRMKLSWFNHMLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKSDDNTLG
ILIGVLVGSLLVAALVCFLLLRKTGRASDQSDFREQQPPASTPGHGPSDSSIS
Download sequence
Identical sequences G3R3H7
XP_004060851.1.27298 ENSGGOP00000009804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]