SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009888 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009888
Domain Number 1 Region: 293-572
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-82
Family Kelch motif 0.00000373
Further Details:      
 
Domain Number 2 Region: 25-134
Classification Level Classification E-value
Superfamily POZ domain 1.13e-34
Family BTB/POZ domain 0.00092
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009888
Domain Number - Region: 147-269
Classification Level Classification E-value
Superfamily ARM repeat 0.0844
Family MIF4G domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009888   Gene: ENSGGOG00000010132   Transcript: ENSGGOT00000010173
Sequence length 608
Comment pep:known_by_projection chromosome:gorGor3.1:5:42215257:42225485:-1 gene:ENSGGOG00000010132 transcript:ENSGGOT00000010173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMESAAASTRFHQPHMERKMSAMACEIFNELRLEGKLCDVVIKVNGFEFSAHKNILCSC
SSYFRALFTSGWNNTEKKVYNIPGISPDMMKLIIEYAYTRTVPITPDNVEKLLAAADQFN
IMGIVRGCCEFLKSELCLDNCIGICKFTDYYYCPELRQKTYMFILHNFEEMVKVSAEFLE
LSVTELKDIIEKDELNVKQEDAVFEAILKWISHDPQNRKQHISILLPKVRLALMHAEYFM
NNVKMNDYVKDSEECKPVIINALKAMYDLNMNGPSNSDFTNPLTRPRLPYAILFAIGGWS
GGSPTNAIEAYDARADRWVNVTCEEESPRAYHGAAYLKGYVYIIGGFDSVDYFNSVKRFD
PVKKTWHQVAPMHSRRCYVSVTVLSNFIYAMGGFDGYVRLNTAERYEPETNQWTLIAPMH
EQRSDASATTLYGKVYICGGFNGNECLFTAEVYNTESNQWTVIAPMRSRRSGIGVIAYGE
HVYAVGGFDGANRLRSAEAYSPVANTWRTIPTMFNPRSNFGIEVVDDLLFVVGGFNGFTT
TFNVECYDEKTDEWYDAHDMSIYRSALSCCVVPGLANVEEYAARRDNFPGLALRDEVKYS
ASTSTLPV
Download sequence
Identical sequences G3R3Q6
XP_004041741.1.27298 ENSGGOP00000009888 ENSGGOP00000009888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]