SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009895 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009895
Domain Number 1 Region: 25-487
Classification Level Classification E-value
Superfamily ALDH-like 7.07e-92
Family ALDH-like 0.00000395
Further Details:      
 
Domain Number 2 Region: 507-768
Classification Level Classification E-value
Superfamily ALDH-like 8.9e-44
Family ALDH-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009895   Gene: ENSGGOG00000010135   Transcript: ENSGGOT00000010180
Sequence length 802
Comment pep:known_by_projection chromosome:gorGor3.1:19:46788402:46808541:1 gene:ENSGGOG00000010135 transcript:ENSGGOT00000010180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRAGPRAREIFTSLEYGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQ
DPITGENLASCLQAQAEDVAAAVEAARMAFRSWSVHPGVVRAQHLTRLAKVIQKHQRLLW
TLESLVTGRAVREVRDGDVQLAQQLLHYHAIQASTQEEALAGWEPMGVIGLILPPTFSFL
EMMWRICPALAVGCTVVALVPPASPTPLLLAQLSGELGPFPGILNVISGSASLVPVLASQ
PGIQKVAFCGALEEGRALRRSLAGECAELGLALGTESLLLLTDTADIDSAVEGVVDAAWS
DRGPGGLRLLIQESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREA
QSQGAQVLQAGDVPSERPFYPPTLVSNLPPASPCAQVEVPWPVVVASPFRTAKEALLVAN
GTPRGGSASVWSERLGQALELGYGLQVGTVWINAHGLRDPSVPTGGCKESGCSWHGGPDG
LYEYLRPSGTPARLSCLSKNLNYDTFGLAVPSTLPAGPEIGPSPAPPYGLFIGGRFQAPG
ARSSKPIRDSSGNLHGYVAEGGAKDIRGAVEAAHQAFPGWAGQSPGARAALLWALAAALE
RRKSTLASRLERQGVELKAAEAEVELSARRLRAWGARVQAQGHTLQVAGLRGPVLRLREP
LGVLAVVCPDEWPLLAFVSLLAPALAYGNTVVTVPSAACPLLALEVCQDMATLFPAGLAN
VVTGDRDHLTRCLALHQDVQAMWYFGSAQGSQFVEWASAGNLKPVWASRGCPRAWDQEAE
GAGPELGLRAARTKALWLPMGD
Download sequence
Identical sequences G3R3R3
ENSGGOP00000009895 ENSGGOP00000009895 XP_018870053.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]