SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009947 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009947
Domain Number 1 Region: 259-435
Classification Level Classification E-value
Superfamily ITPase-like 1.83e-30
Family YjjX-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009947   Gene: ENSGGOG00000010195   Transcript: ENSGGOT00000010235
Sequence length 464
Comment pep:known_by_projection chromosome:gorGor3.1:5:110814584:110845083:1 gene:ENSGGOG00000010195 transcript:ENSGGOT00000010235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPNPAGLAATAMSSTPVPLAATSSFSSPNVSSMESFPPLAYSTPQ
PPLPPVRPSAPLPFVPPPAVPSVPPLVTSMPPPVSPSTAAAFSNPPVSHFPPSTSAPNTL
LPAPPSGPPISGFSVGSTYDITRGHAGRAPQTPLMPSFSAPSGTGLLPTPITQQASLTSL
AQGTGTTSAITFPEEQEDPRFNRGQDEASAGGIWGFIKGVAGNPMVKSVLDKTKHSVESM
ITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQPV
GYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVHGIHL
ETFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGMS
RRQMIYSAARAIANPQRAVSVHGLVEARNFPAPGDMVSLLLGTV
Download sequence
Identical sequences ENSGGOP00000009947 ENSGGOP00000009947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]