SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009963 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009963
Domain Number 1 Region: 1204-1295
Classification Level Classification E-value
Superfamily Immunoglobulin 6.53e-24
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 932-1029
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-23
Family I set domains 0.0084
Further Details:      
 
Domain Number 3 Region: 125-226
Classification Level Classification E-value
Superfamily Immunoglobulin 3.26e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 849-940
Classification Level Classification E-value
Superfamily Immunoglobulin 5.31e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 580-676
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 32-131
Classification Level Classification E-value
Superfamily Immunoglobulin 9.17e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 399-498
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-20
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 1126-1211
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-20
Family I set domains 0.029
Further Details:      
 
Domain Number 9 Region: 220-313
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-19
Family I set domains 0.021
Further Details:      
 
Domain Number 10 Region: 1015-1114
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 11 Region: 751-845
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 12 Region: 486-585
Classification Level Classification E-value
Superfamily Immunoglobulin 3.62e-17
Family I set domains 0.044
Further Details:      
 
Domain Number 13 Region: 677-755
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000205
Family I set domains 0.0066
Further Details:      
 
Domain Number 14 Region: 307-407
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000185
Family I set domains 0.036
Further Details:      
 
Domain Number 15 Region: 1-39
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000257
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009963   Gene: ENSGGOG00000010199   Transcript: ENSGGOT00000010251
Sequence length 1339
Comment pep:novel chromosome:gorGor3.1:9:113940992:113975125:1 gene:ENSGGOG00000010199 transcript:ENSGGOT00000010251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEIQEAQVSDKGLYSCKVSNVAGEAVRTFTLTVQVPPTFENPKTETVSQVAGSPLVLTCD
VSGVPAPTVTWLKDRMPVESSAVHGVVSRGGRLQLSRLQPAQAGTYTCVAENTQAEARKD
FVVAVLVAPRIRSSGVAQEHHVLEGQEVRLDCEADGQPPPDVAWLKDGSPLGQDMGPHLR
FYLDGGSLVLKGLRALDAGAYTCVAHNPAGEDARLHTVNVLVPPTIEQGADGSGTLVSRP
GELVTMVCPVRGSPPIHVSWLKDGLPLPLSQRTLLHGSGHTLRISKVQLADAGIFTCVAA
SPAGVADRNFTLQCPLSWSRWSSRMTWWWFVAPWWNSHARPRAFPCLSCRMKDGEPLLSQ
SLEQGPSLQLEAVGADDSGTYSCVAVSEAGEARRHFQLTVMEPPHIEDSGQPTELSLTPG
APMELLCNAQGTPQPNITWHKNGQALTRLENSSRATRVLRVENVQVRDAGLYTCLAESPA
GAIEKSFRVRVQAPPNIVGPRGPRFVVGLAPGQLVLECSVEAEPAPKITWHRDGIVLQED
AHTQFPERGRFLQLQALSTADSGDYSCTARNAAGSTSVAFRVEIHTVPTIRSGPPAVNVS
VNQTALLPCQADGVPAPLVSWRKDRVPLDPRSPRFEILPEGSLRIQPVLAQDAGHYLCLA
SNSAGSDRQGRDLRVLALLPCEASGSPKPLVVWRKDGQKLDFRLQQGAYRLLPSNALLLT
APGPQDSAQFECVVSNEVGEAHRLYQVTVHVPPTIADDQTDFTVTMMAPVVLTCHSTGIP
APTVSWSKAGAQLGARGSGYRVSPSGALEIGQALPIHAGRYTCSARNSAGVAHKHVFLTV
QASPVVKPLPSVVRAVAEEEVMLPCEASGIPRPTITWQKEGLNVATGVSTQVLPGGQLRI
AHASPEDAGNYLCIAKNSAGSAMGKTRLVVQVPPVIENGPPDLSTTEGSHAFLPCKARGS
PEPNITWDKDGQPVSGAEGKFTIQPSGELLVKNLEGQDAGTYTCTAENAVGRARRRVHLT
ILALPVFTTLPGDRSLHLGDRLWLRCAARGSPTPRIGWTVNDRPVTEGVSEQDGGSTLQR
AAVSREDSGTYVCWAENRVGRTQAVSFVHVKEAPVLQGEAFSYLVEPVGGSIQLDCVVRG
DPVPDIRWIKDGLPLRGSHLRHQLQNGSLTIRRTERDDAGQYQCLAENEMGVAKKVVILV
LQSAPVFQVEPQDMTVRSGDDVALRCQATGEPTPTIEWLQAGQPLRASRRLRTLPDGSLW
LENVETGDAGTYDCVAHNLLGSATARVFLVVRGMGHPCLDLRGQRQDLLPMGTVWCLWET
CPLPCQLPTSSLCFIISPE
Download sequence
Identical sequences ENSGGOP00000009963 ENSGGOP00000009963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]