SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009973 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009973
Domain Number 1 Region: 219-316
Classification Level Classification E-value
Superfamily Immunoglobulin 9.09e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 123-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000475
Family C1 set domains (antibody constant domain-like) 0.032
Further Details:      
 
Domain Number 3 Region: 29-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000407
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009973   Gene: ENSGGOG00000010219   Transcript: ENSGGOT00000010261
Sequence length 421
Comment pep:known_by_projection chromosome:gorGor3.1:11:113035804:113373592:-1 gene:ENSGGOG00000010219 transcript:ENSGGOT00000010261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVVLPSGSQCAAAAAAAPPGDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPN
RQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITV
LVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYT
VTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREG
DALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVG
KAHSDYMLYVYDPPTTIPPPTTTTTTTTTTTTILTIITDSRAGEEGSIRAVDHAVIGGVV
AVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYF
I
Download sequence
Identical sequences G3R3Y8
ENSGGOP00000009973 ENSGGOP00000019552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]