SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010008 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010008
Domain Number 1 Region: 9-291
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.91e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010008   Gene: ENSGGOG00000010259   Transcript: ENSGGOT00000010297
Sequence length 415
Comment pep:known_by_projection chromosome:gorGor3.1:18:13015177:13114173:-1 gene:ENSGGOG00000010259 transcript:ENSGGOT00000010297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
Download sequence
Identical sequences G3RMA5 P17706
NP_002819.2.87134 NP_002819.2.92137 XP_018869732.1.27298 ENSP00000311857 9606.ENSP00000311857 gi|333108231|ref|NP_002819.2| ENSP00000311857 ENSP00000320298 ENSGGOP00000010008 ENSGGOP00000010008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]