SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010048 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010048
Domain Number 1 Region: 557-800
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-83
Family Eukaryotic proteases 0.00000000521
Further Details:      
 
Domain Number 2 Region: 343-453
Classification Level Classification E-value
Superfamily Kringle-like 1.86e-40
Family Kringle modules 0.00000568
Further Details:      
 
Domain Number 3 Region: 452-551
Classification Level Classification E-value
Superfamily Kringle-like 8.22e-34
Family Kringle modules 0.00000552
Further Details:      
 
Domain Number 4 Region: 19-99
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 3.49e-20
Family Hairpin loop containing domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010048   Gene: ENSGGOG00000010300   Transcript: ENSGGOT00000010339
Sequence length 801
Comment pep:known_by_projection chromosome:gorGor3.1:6:161934103:161985286:1 gene:ENSGGOG00000010300 transcript:ENSGGOT00000010339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHREVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDKEFT
CRAFQYHSKEQQCVIMAENRKSSIIVRMRDVVLFEKKAILSSIYETRGGRHYGVIKLNSE
LEMCKSYSSFSIVYFKIYAPIKHIPSSIKTVNSNNLALQTFCIPGVKEDWKHLSSCILED
DLPYCIKSKLYLVKLLVLTSSKQTDSPDSLYKMLTFKYVICKLLTRRLSLLVFKVTEGSK
RLWFCQEQSVLEHIYFCHLPPATLPSPSPRPYHHWLGLLVAVHMISSSIGLKALVCCRYV
RSTFPNHNIVDFHCPCVNLSANTEKRTVIILRGYCTVFVINCFMLLFFHLISAPPELTPV
VQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADK
GPWCFTTDPSVRWEYCNLKKCSGTEASAVAPPPLVQLPNVETPSEEDCMFGNGKGYRGKR
ATTVTGTPCQDWAAQEPHRHSIFTPETNPRASLEKNYCRNPDGDAGGPWCYTTNPRKLYD
YCDVPQCACATAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRLGMHFCGG
TLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRTDIALL
KLSSPAIITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGRLKEAQLPVIENKVC
NRYEFLNGRVKSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNK
PGVYVRVSRFVTWIEGVMRNN
Download sequence
Identical sequences ENSGGOP00000010048 ENSGGOP00000010048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]