SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010052 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010052
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily POZ domain 7.46e-22
Family BTB/POZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 509-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000213
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 484-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000692
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010052   Gene: ENSGGOG00000010306   Transcript: ENSGGOT00000010343
Sequence length 665
Comment pep:known_by_projection chromosome:gorGor3.1:X:117585270:117587288:1 gene:ENSGGOG00000010306 transcript:ENSGGOT00000010343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNILSASSTYFHQL
FSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGVKFIAELGVPL
SQVKSISGTAQDGNTETLPPDSGDKNLVIQKSKDEAQDNGATIMPIITESFSLSAEDYEM
KKIIVTDVIFCSEILPTKETLPSNNTVAQVQSNPGPVAISDVAPSASNNSPPLTNITPTQ
KLPTPVNQATLSQTQGSEKLLVSSAPTHLTPNIILLNQTPLSTPPNVSSSLPNHMPSSIN
LLVQNQQTPNSAILTGNKANEEEEEEIIDDDDDTISSSPDSAVSNTSLVPQADTSQNTSF
DGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGLGSKHLMEGQKIITLDTATEIEGL
STGCKVYANIGEDTYDIVIPVKDDPDEGEARLENEIAKTSGSEMANKRMKVKHDDHYELI
VDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGE
RRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTI
PAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFI
IPESY
Download sequence
Identical sequences ENSGGOP00000010052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]