SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010088 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010088
Domain Number 1 Region: 28-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.93e-20
Family I set domains 0.026
Further Details:      
 
Domain Number 2 Region: 147-239
Classification Level Classification E-value
Superfamily Immunoglobulin 2.35e-20
Family I set domains 0.0046
Further Details:      
 
Domain Number 3 Region: 244-362
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-16
Family I set domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010088   Gene: ENSGGOG00000010340   Transcript: ENSGGOT00000010381
Sequence length 504
Comment pep:known_by_projection chromosome:gorGor3.1:4:1026370:1038931:1 gene:ENSGGOG00000010340 transcript:ENSGGOT00000010381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPSPLLLLLLPPLLLGAFPPAAAARGPPRMADKVVPRQVARLGRTVRLQCPVEGDPPPL
TMWTKDGRTIHSGWSRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDI
SPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRP
DITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQ
RTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGG
QKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPK
PPGPPVASSSSATSLPWPVVIGIPAGAVFILGTLLLWLCQAQKKPCTPAPAPPLPGHRPL
GTARDRSGDKDLPSLAALSAGPGVGLCEEHGSPAAPQHLLGPGPVAGPKLYPKLYTDIHT
HTHTHSHTHSHVEGKVHQHIHYQC
Download sequence
Identical sequences G3R495
ENSGGOP00000010088 ENSGGOP00000010088 XP_018880767.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]