SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010126 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010126
Domain Number 1 Region: 288-402
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-36
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 2 Region: 132-241
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-33
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 3 Region: 452-565
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 8.63e-29
Family Frizzled cysteine-rich domain 0.0003
Further Details:      
 
Domain Number 4 Region: 246-282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 407-441
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000122
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010126   Gene: ENSGGOG00000010376   Transcript: ENSGGOT00000010420
Sequence length 567
Comment pep:novel chromosome:gorGor3.1:11:117287182:117294913:-1 gene:ENSGGOG00000010376 transcript:ENSGGOT00000010420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDFSDVILCMEATESSKTEFCNPAFEPESGPPCPPPVFPEDASYSVPAPWHGRRPRGLR
PDCRFSWLCVLLLSSLLLLLLGLLVAIILAQLQAAPPSGASHSPLPAGGPQAAGIPKGQQ
ESGVSPSPQSTCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE
SVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNASHLLVVFVSDSSVEGFGFHAWYQA
VAPGHGSCAHDEFRCDQLICLLPDSVCDGFSNCADGSDETNCSAKFSGCGGNLTGLQGTF
STPSYLQQYPHQLLCTWHISVPAGHSIELQFHNFSLEAQDECKFDYVEVYETSSSGAFSL
LGRFCGAEPPPHLVSSHHELAVLFRTDHGISGGGFSATYLAFNATENPCGPSELSCQAGG
CKGVQWMCDMWRDCTDGSDDNCSGPLFPPPELACEPVQVEMCLGLSYNTTAFPNIWVGMT
TQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSG
LALLGTPWPFNCNRLPEAADLEACAQP
Download sequence
Identical sequences ENSGGOP00000010126 ENSGGOP00000010126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]