SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010152 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010152
Domain Number 1 Region: 37-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000138
Family V set domains (antibody variable domain-like) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010152   Gene: ENSGGOG00000010409   Transcript: ENSGGOT00000010448
Sequence length 200
Comment pep:known_by_projection chromosome:gorGor3.1:11:91135965:91165669:-1 gene:ENSGGOG00000010409 transcript:ENSGGOT00000010448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLPSGRRKTRGISLGLFALCLAAARCLQSQGVSLYIPQATINATVKEDILLSVEYSCH
GVPTIEWTYSSNWGTQKIVEWKPGTQANISQSHKDRVCTFDNGSIQLFSVGVRDSGYYVI
TVTERLGSSQFGTIVLHVSEILYEDLHFVAVILAFLAAVAAVLISLMWVCNKCAYKFQRK
RRHKLKESTTEEIELEDVEC
Download sequence
Identical sequences A0A096NZQ2 A0A2K5XTN6 A8MXK1 G3R4F1
NP_001138343.1.87134 NP_001138343.1.92137 XP_011850407.1.47321 ENSP00000386607 ENSGGOP00000010152 ENSP00000386607 9606.ENSP00000386607 gi|221554524|ref|NP_001138343.1| ENSGGOP00000010152 ENSP00000381277 ENSPANP00000018577 NYSGRC-IgSF-CK090_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]