SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010198 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010198
Domain Number 1 Region: 423-605
Classification Level Classification E-value
Superfamily Fibronectin type III 3.19e-36
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 329-424
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-26
Family I set domains 0.0065
Further Details:      
 
Domain Number 3 Region: 141-228
Classification Level Classification E-value
Superfamily Immunoglobulin 2.78e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 44-134
Classification Level Classification E-value
Superfamily Immunoglobulin 9.21e-18
Family I set domains 0.0081
Further Details:      
 
Domain Number 5 Region: 238-329
Classification Level Classification E-value
Superfamily Immunoglobulin 3.45e-17
Family I set domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010198   Gene: ENSGGOG00000010452   Transcript: ENSGGOT00000010497
Sequence length 781
Comment pep:known_by_projection chromosome:gorGor3.1:15:44601594:44651366:-1 gene:ENSGGOG00000010452 transcript:ENSGGOT00000010497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQRAASPRRPLAPCWPRLLLPLLLLLLPAPSEGLGHSAELAFAVEPSDDVAVPGQPIV
LDCRVEGTPPVRITWRKNGVELPESPHSTLLANGSLMIRHFRLERGGSPSDEGDYECVAQ
NRFGLVVSRKARIQAATMSDFHVHPQATVGEEGGVARFQCQIHGLPKPLITWEKNRVPID
TDNERYTLLPKGVLQITGLRAEDSGIFHCVASNIASIRISHGARLTVSGSGSGAYKEPAI
LVGPENLTLTVHQTAVLECVATGNPRPIVSWSRLDGRPIGVEGIQVLGTGNLIISDVTVQ
HSGVYVCAANRPGTRVRRTAQGRLVVQAPAEFVQHPQSISRPAGTTAMFTCQAQGEPPPH
VTWLKNGQVLGPGGHVRLKNNNSTLTISGIGPEDEAIYQCVAENSAGSSQASARLTVLWA
EGLPGPPRNVRAVSVSSTEVRVSWSEPLANTKEIIGYVLHIRKAADPPELEYQEAVSKST
FQHLVSDLEPSTAYSFYIKAYTPRGASSASVPTLVSTLGEAPAPPPLSVRVLGSSSLQLL
WEPWPRLAQHEGGFKLFYRPASKTSFTGPILLPGTVSSYNLSQLDPTTVYEVKLLAYNQH
GDGNATVRFVSLRGASERTVLSPPCDCRKEEAANQTSTTGIVIGIHIGVTCIIFCVLFLL
FGQRGRVLWCKDVENQLSPPQGPRSQRDPGILALNGARRGERGRLGRDEKRVDMKELEQL
FPPAGTAGQPDPRPTQDPAAPAPCEETQLSVLPLQGCGLMEGKTTEAKTTEATAPCAGLA
A
Download sequence
Identical sequences ENSGGOP00000010198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]