SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010213 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010213
Domain Number 1 Region: 782-861
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-20
Family SH3-domain 0.00079
Further Details:      
 
Domain Number 2 Region: 1232-1290
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-19
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 863-950
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-18
Family SH3-domain 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010213
Domain Number - Region: 175-208
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.0837
Family Iron-containing alcohol dehydrogenase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010213   Gene: ENSGGOG00000010457   Transcript: ENSGGOT00000010512
Sequence length 1292
Comment pep:known_by_projection chromosome:gorGor3.1:10:108602265:108799101:-1 gene:ENSGGOG00000010457 transcript:ENSGGOT00000010512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSECDGGSKAVVNGLALGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMD
PTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADA
NGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSIAAQPEVIVVPLYLVNTDRGQEGTARPP
TPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPS
FSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPPVSKPSSA
YPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAAEKRAK
DDSRRVVKSAQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYK
FPELPEIQQTSKEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSK
SEMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQP
GKSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDR
KTNLDKDLSLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEISSETPGYIYSSNFHA
VKRESDGTPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPA
DYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDL
LNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVG
IFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAVAKFNFNGDTQVEMSFRKGERITLLRQV
DENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQFSSHS
KLITPAPSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTPPLPPLPEASIYNTDH
LALSPRASPSLSLSLPHLSWSDRPTPRSVASPLALPSPHKTYSLAPTSQASLHMNGDGGV
HTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPWREESGQYERKAERGAGERGP
GGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEAEQTERHRGGE
QAGRKAARRGGSQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDV
MEKCDDGWFVGTSRRTRQFGTFPGNYVKPLYL
Download sequence
Identical sequences ENSGGOP00000010213 ENSGGOP00000010213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]