SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010218 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010218
Domain Number 1 Region: 428-621
Classification Level Classification E-value
Superfamily Fibronectin type III 2.79e-39
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 2 Region: 748-945
Classification Level Classification E-value
Superfamily Fibronectin type III 2.97e-39
Family Fibronectin type III 0.00052
Further Details:      
 
Domain Number 3 Region: 328-423
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-21
Family I set domains 0.0021
Further Details:      
 
Domain Number 4 Region: 145-231
Classification Level Classification E-value
Superfamily Immunoglobulin 3.66e-21
Family I set domains 0.032
Further Details:      
 
Domain Number 5 Region: 245-340
Classification Level Classification E-value
Superfamily Immunoglobulin 8.89e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 6 Region: 629-727
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000938
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 7 Region: 46-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000824
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010218   Gene: ENSGGOG00000010463   Transcript: ENSGGOT00000010517
Sequence length 1251
Comment pep:known_by_projection chromosome:gorGor3.1:15:44655401:44686042:-1 gene:ENSGGOG00000010463 transcript:ENSGGOT00000010517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGKGSVGVCRFLWGLGFCLFKIYRELLLPQETTVELSCGVGPLQVILGPEQAAVLNCSLG
ATAAGPPTRVTWSKDGDTLLEHDHLHLLPNGSLWLSQPLAPNGSDELVPEAVGVIEGSYS
CLAHGPLGVLASQTAVVKLATLADFSLHPESQMVEENGTARFECHIEGLPVPIITWEKDQ
VTLPEEPRLIVLPNGVLQILDVQESDAGPYRCVATNSARQHFSQEALLSVAHRGSLASTR
GQDVVIVAAPENTTVVSGQSVVMECVASADPTPFVSWVRQDGKPISTDVIVLGRTNLLIA
SAQPRHSGIYVCRANKPRTRDFATAAAELRVLAAPAITQAPEALSRTRASTARFVCRASG
EPRPALRWLHNGAPLRPNGRVKVQGGGGSLVITQIGLQDAGYYQCVAENSAGMACAAASL
AVVVREGLPSAPTRVTATPLSSSAVLVAWERPELHSEQIIGFSLHYQKARGMDNVEYQFA
VNNDTTELQVRDLEPNTDYEFYVVAYSQLGASRTSTPALVHTLDDVPSAAPQLSLSSPNP
SDIRVAWLPLPPSLSNGQVVKYKIEYGLGKEDQIFSTEVRGNETQLMLNLLQPNKVYRVR
ISAGTAAGFGAPSQWMHHRTPSMHNQSHVPFAPAELKVQAKMESLVVSWQPPPHPTQISG
YKLYWREVGAEEEANGDRLPGGRGDQAWDVGPVRLKKKVKQYELTQLVPGRLYEVKLVAF
NKHEDGYAAVWKGKTEKAPAPDMPIQRGPPLPPAHVHAESNSSTSIWLRWKKPDFTTVKI
VNYTVRFSPWGLRNASLVTYYTSSSGEDILIGGLKPFTKYEFAVQSHGVDMDGPFGSVVE
RSTLPDRPSTPPSDLRLSPLTPSTVRLHWCPPTEPNGEIVEYLILYSNNHTQPEHQWTLL
TTQGNIFSAEVHGLESDTRYFFKMGARTEVGPGPFSRLQDVITLQEKLSESLDMHSVTGI
IVGVCLGLLCLLACMCAGLRRSPHRESLPGLSSTATPGNPALYSRARLGPPSPPAAHELE
SLVHPHLQDWSPPPSDVEDRAEVHSLMGGGVSEGRSHSKRKISWAQPSGLSWAGSWAGCE
LPQAGPRPALTRALLPPAGTGQTLLLQALVYDAIKGNGRKKSPPACRNQVEAEVIVHSDF
SASNGNPDLHLQDLEPEDPLPLEAPDLISGVGDPGQGAAWLDRELGGCELAAPGPDRLTC
LPEAASASCSYPDLQPGEVLEETPGDSCQLKSPCPLGASPGLPRSPVSSSA
Download sequence
Identical sequences ENSGGOP00000010218 ENSGGOP00000017644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]