SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010233 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010233
Domain Number 1 Region: 122-292,327-493
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.13e-78
Family YicI catalytic domain-like 0.00075
Further Details:      
 
Domain Number 2 Region: 991-1189,1233-1394
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.27e-72
Family YicI catalytic domain-like 0.00041
Further Details:      
 
Domain Number 3 Region: 738-988
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.59e-43
Family YicI N-terminal domain-like 0.0044
Further Details:      
 
Domain Number 4 Region: 3-121
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.82e-27
Family YicI N-terminal domain-like 0.011
Further Details:      
 
Domain Number 5 Region: 1397-1477
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.1e-19
Family Putative glucosidase YicI, domain 3 0.0055
Further Details:      
 
Domain Number 6 Region: 496-576
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.31e-16
Family Putative glucosidase YicI, domain 3 0.013
Further Details:      
 
Domain Number 7 Region: 710-759
Classification Level Classification E-value
Superfamily Trefoil 0.000000000235
Family Trefoil 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010233   Gene: ENSGGOG00000010479   Transcript: ENSGGOT00000010532
Sequence length 1621
Comment pep:novel chromosome:gorGor3.1:7:140574200:140660835:1 gene:ENSGGOG00000010479 transcript:ENSGGOT00000010532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPIFTRDATPTESGG
MINLYGAHTFFLCLEDASGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGILDFYVFLGNT
PEQVVQEYLELVGRPFLPPYWSLGFQLSRRDYGDINKLKEVVSRNRLAEIPYDVQYSDID
YMDGKKDFTVDEVAYSGLPDFVKELHDNGQKYLIIMNPGISKNSNYEPYNNGSLKRVWIL
GNNGFAVGEGYPGPTVFPDYTNPVCTEWWTDQVAKFHDHLEFDGVWIEMNEVSSLLQASN
NQCESNNLNFPPFLPRVLDHLLFARTLCMDTEFHGGLHYDIHSLYGHSMARTTNLALETI
FMNNRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGY
NNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGVDSLLLKSSRHYLNIRYTLLP
YLYTLFYRAHTRGETVARPLVHEFYQDSATWDVHEQFLWGPGLLITPVLYEGVDEVKAYI
PDAIWYDYETGVAIPWRKQLVNMLLPGDKIGLHLRGGYIFPTQKPNTTTEASRRNSLGLM
IALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLQAKIINNNYMDTDNLMFTD
ITILGMDKQPANFIVLLNNVATSSPSVVYNASTKVVTITDLQGLVLGQEFSIRWNLPVSD
LEKFNCYPDNPTASEESCRQRGCLWEDTSTPGVPTCYYDTIPNYVASDIQYLNTSITADL
SLLMAPESAAAAASDSLSAKISFLHLNVIYHTATMLQVKIYDPTNKRYEVPVPLNTPPQP
VGDPENRLYDVRIQNNPFGIQIQRKNSSAVIWDSQLPGFTFNDMFLSISTRLPSQYIYGF
GETEHTTFRRNMNWNTWGMFARDEPPAYKKNSYGVHPYYMALEEDGSAHGVLLLNSNAMD
VTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPYWALGFHLSRYGYQ
NDAEISSLYDAMVAAQVPYDVQHVDIDYMNRKLDFTLSANFQNLSLLIEQMKKNGMRFIL
VLDPAISGNETQYLPFIRGQENNVFIKWPDTNDIVWGKVWPDLPNVIVDGSLDHETQVKL
YRAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLWIDMNEPSNFVDGSVRGC
SNEMLNNPPYMPYLESRDKGLSSKTLCMESQQILPDSSPVEHYNVHNLYGWSQTRPTYEA
VQEVTGQRGVIITRSTFPSSGRWGGHRLGNNTAAWDQLGKSIIGMMEFSLFGIPYTGADI
CGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNSTFEMLSRKVLETRYTLL
PYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDHQFMLGPAILISPVLETSTFEISAY
FPRARWYDYSTGTSSTSTGQRKILKAPLDHINLHVRGGYILPWQEPAMNTHSSRQNFMGL
IVALDDNGTAEGQVFWDDGQSIDTYENGNYFLANFIAAQNILQIQTIHNKYLSDSNPLKV
GYIRIWGVNTYVTQVSFTYDNQQFMETNFKSEPYNQILTIQLTDRTINLEKLTEVTWIDG
G
Download sequence
Identical sequences ENSGGOP00000010233 ENSGGOP00000010233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]