SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010269 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010269
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily POZ domain 9.81e-23
Family BTB/POZ domain 0.0078
Further Details:      
 
Domain Number 2 Region: 360-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000092
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 250-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000606
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 444-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000364
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010269   Gene: ENSGGOG00000010529   Transcript: ENSGGOT00000010570
Sequence length 514
Comment pep:known_by_projection chromosome:gorGor3.1:6:152385903:152395791:-1 gene:ENSGGOG00000010529 transcript:ENSGGOT00000010570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLANHGLILLQQLNAQREFGFLCDCTVAIGDVYFKAHKSVLASFSNYFKMLFVHQTSEC
VRLKPTDIQPDIFSYLLHLMYTGKMAPQLIDPVRLEQGIKFLHAYPLIQEASLASQGAFS
HPDQVFPLASSLYGIQIADHQLRQATKIASAPEKLGRDPRPQTSRISQEQVPEASQLSQL
TSNLAQVNRTNMTPSDPLQTSLSPELVSTPVPPPPPGEETNLEASSSDEQPASLTIAHVK
PSIMKRNGSFPKYYACHLCGRRFTLRSSLREHLQIHTGVPFTSSQQGESRVPLTLCSNAA
DLGKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDNLEQADQEREVKR
RKYECTICGRKFIQKSHWREHMYIHTGKPFKCSTCDKSFCRANQAARHVCLNQSIDTYTM
VDKQTLELCTFEEGSQMDNMLVQTNKPYKCNLCDKTFSTPNEVVKHSCQNQNSDVFALDE
GRAILLGSGDSEVTEPDHPVLASIKKEQETVLLD
Download sequence
Identical sequences G3R4Q8 K7BHW5
ENSGGOP00000010269 XP_003811550.1.60992 XP_004044879.1.27298 ENSGGOP00000010269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]