SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010271 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010271
Domain Number 1 Region: 120-212
Classification Level Classification E-value
Superfamily Immunoglobulin 3.37e-22
Family I set domains 0.00000315
Further Details:      
 
Domain Number 2 Region: 26-118
Classification Level Classification E-value
Superfamily Immunoglobulin 7.38e-20
Family I set domains 0.00000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010271   Gene: ENSGGOG00000010527   Transcript: ENSGGOT00000010572
Sequence length 304
Comment pep:known_by_projection chromosome:gorGor3.1:19:52398993:52405364:1 gene:ENSGGOG00000010527 transcript:ENSGGOT00000010572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQATICCQGNYGAVEYQL
HFEGSLFAVDRPKAPERINKVKFYIPDMNSRMAGQYSCIYRAGELWSEPSNLLDLVVTEM
YDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPV
TTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADPWDTYLLTTET
GLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLN
TKTL
Download sequence
Identical sequences G3R4R0
ENSGGOP00000010271 XP_004061487.1.27298 ENSGGOP00000010271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]