SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010331 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010331
Domain Number 1 Region: 456-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.17e-59
Family Eukaryotic proteases 0.0000328
Further Details:      
 
Domain Number 2 Region: 381-473
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-34
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 3 Region: 204-287
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-33
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 4 Region: 295-378
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-30
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 5 Region: 121-203
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-29
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 6 Region: 34-119
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.69e-16
Family Hairpin loop containing domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010331   Gene: ENSGGOG00000010588   Transcript: ENSGGOT00000010635
Sequence length 725
Comment pep:known_by_projection chromosome:gorGor3.1:3:50971247:50976076:-1 gene:ENSGGOG00000010588 transcript:ENSGGOT00000010635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLWWVTVQPPARRMGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPW
QEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKGN
VRTCIMNNGVGYRGTMATTVGGLPCQTWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGG
PWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFE
PGKFLDQGLDDNYCRNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRG
KGEGYRGTANTTTAGVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTL
RPGMRVAFCYQIRRCTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTF
TSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFE
KCGKRVDRLDQRRSKLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFFS
CHMPLTGYEVWLGTLFQNPQHGEPGLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVAL
ICLPPEWYVVPPGTKCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMC
TEGLLAPVGACEGDYGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVFVDWIHK
VMRLG
Download sequence
Identical sequences ENSGGOP00000010331 ENSGGOP00000010331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]