SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010432 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010432
Domain Number 1 Region: 439-576
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.19e-34
Family Mismatch glycosylase 0.000000157
Further Details:      
 
Domain Number 2 Region: 60-180
Classification Level Classification E-value
Superfamily DNA-binding domain 9.81e-33
Family Methyl-CpG-binding domain, MBD 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010432   Gene: ENSGGOG00000010698   Transcript: ENSGGOT00000010739
Sequence length 580
Comment pep:known_by_projection chromosome:gorGor3.1:3:129368768:129377613:-1 gene:ENSGGOG00000010698 transcript:ENSGGOT00000010739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTGLESLCLGDRGAAPTVTSSERLVPDPRKSLDKEDVAMELERVGEDEEQMMIKRSSE
CNPLLQEPIASAQFGATAGTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRS
KSSLANYLHKNGETSLKPEDFDFTVLSKRGLKSRYKDYSMAALTSHLQNQSNNSNWNLRT
RSKCKKDVFMPPSSSSELRESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKG
IPIKKTKKGCRKNCSGFVQSDSKRESVCNKADAESEPVAQKSQLDRTVCISDAGECGETL
SVTSEKNSLVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEKYEDTFLEPEEIGT
KVEVVERKEHLHTDILKRGSEMDNNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSS
KYNKEALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWK
FLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKY
GNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
Download sequence
Identical sequences ENSGGOP00000024137 ENSGGOP00000010432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]