SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010439 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010439
Domain Number 1 Region: 20-95
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000187
Family C1 set domains (antibody constant domain-like) 0.039
Further Details:      
 
Domain Number 2 Region: 97-190
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000102
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010439   Gene: ENSGGOG00000010705   Transcript: ENSGGOT00000010746
Sequence length 274
Comment pep:known_by_projection chromosome:gorGor3.1:19:41856378:41868307:1 gene:ENSGGOG00000010705 transcript:ENSGGOT00000010746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPQNTAEVQKVQLTGEPVPVARCVSTGGRPPAQITWRSDLGGMPNTSQVPGFLSGTVTVT
SLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEAI
LTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQA
ELTVQVKEGPPSEHSGMSRNAIIFLVLGILIFLILLGIGIYFYWSRCSREFLWHCHLCPS
STEHASASANGHISYSAVSRENSSFQDPQTEGTR
Download sequence
Identical sequences G3R570
ENSGGOP00000010439 ENSGGOP00000010439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]