SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010482 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010482
Domain Number 1 Region: 29-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000175
Family V set domains (antibody variable domain-like) 0.043
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010482
Domain Number - Region: 287-343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000447
Family C1 set domains (antibody constant domain-like) 0.018
Further Details:      
 
Domain Number - Region: 480-547
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 0.0368
Family Bcl-2 inhibitors of programmed cell death 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010482   Gene: ENSGGOG00000010741   Transcript: ENSGGOT00000010790
Sequence length 585
Comment pep:known_by_projection chromosome:gorGor3.1:3:110818557:110914845:1 gene:ENSGGOG00000010741 transcript:ENSGGOT00000010790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKKWKYCAVYYIIQIHFVKGVWEKTVNTEENVYATLGSDVNLTCQTQTIGFFVQMQWSK
VTNKVDLIAVYHPQYGFYCAYGRPCESLVTFTETPENGSKGTLHLRNMSSSVSGRYECML
ILYPEGIQTKIYNLLIQTHVTPDEWKSNHTIEIEINQTLEIPCFQNSSSEISSEFTYAWS
VENSSTDSWVLLSKGIKEDNGTQETLISQNHLISNSTLLKDRVKLGTDYRLHLSPVQIFD
DGRKFSCHIRVGPNKILRSSTTVKVFGKGFCSTEFANNPFSVLPQRRFTCLLKNVFPKAN
ITWFIDGSFLHDEKEGIYITDEERKGKDGFLELKSVLTRVHSNKPAQSDNLTIWCMALSP
VPGNKVWNISSEKITFLLGSETSSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLV
DVSALRPNTTPQPSNSSMTTRGFNYPWTSSGTDAKKSVSRIPSETYSSSPSGAGSTFHDN
VFTSTARAFSEVPTTANGSTKTNHVHITGIVVNKPKDGMSWPVIVAALLFCCMILFGLGV
RKWCQYQKEIMERPPPFKPPPPPIKYTCIQEPNESDLPYHEMETL
Download sequence
Identical sequences ENSGGOP00000010482 ENSGGOP00000010482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]