SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010540 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010540
Domain Number 1 Region: 22-140
Classification Level Classification E-value
Superfamily Immunoglobulin 8.9e-22
Family V set domains (antibody variable domain-like) 0.0000473
Further Details:      
 
Domain Number 2 Region: 143-227
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-17
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010540   Gene: ENSGGOG00000010809   Transcript: ENSGGOT00000010850
Sequence length 364
Comment pep:known_by_projection chromosome:gorGor3.1:19:48557965:48572890:1 gene:ENSGGOG00000010809 transcript:ENSGGOT00000010850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLLLLPLLWAGALAMDPKIRLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYW
FREGPFVSGDSPVATNKLDQEVQEETQGRFRLLGDLSRNNCSLSIVDARRRDNGSYFFRM
ERGSTKYSYKSPQLSVHVTDLTHRPKIVIPGALDPGHSKNLTCSVSWACEQGTPPIFSWL
SAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYAPQNPTN
GIFPGDCSGKQETRAGVVHGAIGGAGITALFALCLCLIFFIVKTHRRKAARTAVGRNDTH
PTTGPASPKHQKKSKLHGPTETSSSSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSE
VRTQ
Download sequence
Identical sequences G3SD55
ENSGGOP00000010540 XP_004061325.1.27298 ENSGGOP00000010540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]