SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010547 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010547
Domain Number 1 Region: 76-222
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.02e-40
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00025
Further Details:      
 
Domain Number 2 Region: 1-66
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 6.28e-30
Family Hedgehog (development protein), N-terminal signaling domain 0.0000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010547   Gene: ENSGGOG00000010818   Transcript: ENSGGOT00000010857
Sequence length 284
Comment pep:known_by_projection chromosome:gorGor3.1:2b:108015752:108018245:-1 gene:ENSGGOG00000010818 transcript:ENSGGOT00000010857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGL
LARLVEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGSTTFSDVLIFL
DREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVA
GVPGLQPARVAAVSTHVALGAYAPLTRHGTLVVEDVVASCFAAVADHHLAQLAFWPLRLF
HSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS
Download sequence
Identical sequences ENSGGOP00000010547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]