SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010658 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010658
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.66e-37
Family MHC antigen-recognition domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 119-215
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-25
Family C1 set domains (antibody constant domain-like) 0.0000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010658   Gene: ENSGGOG00000010941   Transcript: ENSGGOT00000010976
Sequence length 273
Comment pep:novel chromosome:gorGor3.1:6:33776591:33780868:-1 gene:ENSGGOG00000010941 transcript:ENSGGOT00000010976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSHVGMFVALTKLGQPDAEQWNSRLDLLERSREAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIRWFLNGQEERAGVMSTGPIRNGDWT
FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Download sequence
Identical sequences G3R5S5
ENSGGOP00000010658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]