SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010666 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010666
Domain Number 1 Region: 139-454
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 3.92e-65
Family ABC transporter transmembrane region 0.0008
Further Details:      
 
Domain Number 2 Region: 458-643
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.61e-59
Family ABC transporter ATPase domain-like 0.00000119
Further Details:      
 
Domain Number 3 Region: 672-726
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 0.00000000000000276
Family MHC antigen-recognition domain 0.00041
Further Details:      
 
Domain Number 4 Region: 726-768
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000137
Family C1 set domains (antibody constant domain-like) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010666   Gene: ENSGGOG00000010941   Transcript: ENSGGOT00000010984
Sequence length 768
Comment pep:novel chromosome:gorGor3.1:6:33777583:33802584:-1 gene:ENSGGOG00000010941 transcript:ENSGGOT00000010984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLG
FVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLS
PPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPRYSGRVIDIL
GGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGF
FQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHM
PFTIAAEKVYNTRHQAVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALE
QCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVG
SYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNR
PDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHC
YLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDV
GEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQANGFWVGPLGGGSASES
DPTGFLHDSRNRLSSHVGMFVALTKLGQPDAEQWNSRLDLLERSREAVDGVCRHNYRLGA
PFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIRWFLNG
Download sequence
Identical sequences ENSGGOP00000010666 ENSGGOP00000010666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]